General Information

  • ID:  hor000126
  • Uniprot ID:  O77668
  • Protein name:  Orexin-A
  • Gene name:  HCRT
  • Organism:  Sus scrofa (Pig)
  • Family:  Orexin family
  • Source:  Animal
  • Expression:  Hypothalamus
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0031771 type 1 orexin receptor binding; GO:0031772 type 2 orexin receptor binding
  • GO BP:  GO:0001659 temperature homeostasis; GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior; GO:0030431 sleep; GO:0042594 response to starvation; GO:0042755 eating behavior; GO:0046928 regulation of neurotransmitter secretion; GO:0051971 positive regulation of transmission of nerve impulse; GO:0120162 positive regulation of cold-induced thermogenesis
  • GO CC:  GO:0005783 endoplasmic reticulum; GO:0005791 rough endoplasmic reticulum; GO:0031410 cytoplasmic vesicle; GO:0045202 synapse; GO:0048471 perinuclear region of cytoplasm

Sequence Information

  • Sequence:  QPLPDCCRQKTCSCRLYELLHGAGNHAAGILTL
  • Length:  33(34-66)
  • Propeptide:  MNPPFAKVSWATVTLLLLLLLLPPAVLSPGAAAQPLPDCCRQKTCSCRLYELLHGAGNHAAGILTLGKRRPGPPGLQGRLQRLLQASGNHAAGILTMGRRAGAEPAPRLCPGRRCLAAAASSVAPGGRSGI
  • Signal peptide:  MNPPFAKVSWATVTLLLLLLLLPPAVLSPGAAA
  • Modification:  T1 Pyrrolidone carboxylic acid;T33 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Play a significant role in the regulation of food intake and sleep-wakefulness
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  HCRTR1, HCRTR2
  • Target Unid:   O97661, O62809
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  6-12; 7-14
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000126_AF2.pdbhor000126_ESM.pdb

Physical Information

Mass: 415418 Formula: C152H249N47O45S4
Absent amino acids: FMVW Common amino acids: L
pI: 7.95 Basic residues: 5
Polar residues: 12 Hydrophobic residues: 10
Hydrophobicity: -6.06 Boman Index: -3883
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 91.82
Instability Index: 2749.09 Extinction Coefficient cystines: 1740
Absorbance 280nm: 54.38

Literature

  • PubMed ID:  10754114
  • Title:  Linkage and Physical Mapping of the Porcine Prepro-Orexin Gene